PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5640	NLT13_PARJU	--NA--	"Parietaria judaica"	Urticaceae	--NA--	Signaling-peptide	"Allergen; Lipid-binding; Signal; Transport | Probable non-specific lipid-transfer protein 1 precursor (LTP) (Major,pollen allergen Par j 1.0201) (Par j I) (P1 protein)."	--NA--	GKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVLHYKGNLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDMRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC	138	"Experimental evidence at protein level"	14413.77	14404.25	8.16	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.ALLERGEN:Causes an allergic reaction in human. Binds to IgE and induces histamine release from basophils of Pj-pollen-allergic subjects.SIMILARITY:Belongs to the plant LTP family."