PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5638	CYT11_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"Plant defense; Protease inhibitor; Secreted; Signal; Thiol protease inhibitor | Putative cysteine proteinase inhibitor 11 precursor (Oryzacystatin-11),(Oryzacystatin XI) (OC-XI).Secreted (Potential)."	--NA--	GKHNQLGTNDRLQFVRVVAAEEQVVQGSNYLVVIDAASSRKKTRELYVAVMARHPGLLLILLAAVAAVATTSRAQWVGGWNVIEDVAGNNQIQRVGAWAVVADLVGATTYQLSSFKLATK	120	"Protein inferred from homology"	12901.82	12893.94	9.77	--NA--	"FUNCTION:Specific inhibitor of cysteine proteinases. Probably involved in the regulation of endogenous processes and in defense against pests and pathogens (By similarity).SIMILARITY:Belongs to the cystatin family. Phytocystatin subfamily."