PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5635	RAG1_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"Allergen; Secreted; Signal | Seed allergenic protein RAG1 precursor (Seed allergenic protein RA17).Secreted."	--NA--	GIYRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCMASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGAASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSYWLGYPRTPRTGH	163	"Experimental evidence at protein level"	17568.13	17556.47	7.07	--NA--	"PTM:Five disulfide bonds are present.ALLERGEN:Causes an allergic reaction in human.SIMILARITY:Belongs to the cereal trypsin/alpha-amylase inhibitor family."