PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5634	EXPA1_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"Cell wall; Cell wall biogenesis/degradation; Membrane; Secreted; Signal | Expansin-A1 precursor (OsEXPA1) (Alpha-expansin-1) (OsEXP1),(OsaEXPa1.16) (RiExA).Secreted, cell wall; Peripheral membrane protein (By similarity)."	--NA--	GIVPVMYQRVPCAKQGGVRFTINGRDYFELVLVSNVGGVGSIQSVSIKGSGQTFSTSQQFSISGTSVTITATNLCPPNYALPNDAGGWCNPPRQHFDMAEPAWLKIGVYVGMAGSSAATSCARFLALLATCLLWNEAASFTASGWNKAFATFYGGSDASGTMGGACGYGDLYSTGYGTNTAALSTVLFNDGASCGQCYRIMCDYQADRRFCRTGWMAMSRNWGVNWQSNAYLDGQSLSFKVTSSDGQTLTFLDVAPAGWTF	261	"Experimental evidence at transcript level"	27748.18	27730.1	7.62	--NA--	"FUNCTION:May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence (By similarity).TISSUE SPECIFICITY:Expressed in adventitious root primordia, coleoptiles, shoot apex, leaf primordia, panicles and flowers.DEVELOPMENTAL STAGE:Expressed in the apical region (growing zone) of the root hair. Expressed in the basal growing zone of air-grown internode. Expressed in the growing region of leaves. Expressed in the developing seeds.INDUCTION:By gibberellin (GA3) and wounding.SIMILARITY:Belongs to the expansin family. Expansin A subfamily.SIMILARITY:Contains 1 expansin-like CBD domain.SIMILARITY:Contains 1 expansin-like EG45 domain. "
