PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5627	MCPI_SOLLC	--NA--	"Solanum lycopersicum, Lycopersicon esculentum"	Solanaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Knottin; Metalloenzyme inhibitor; Pyrrolidone carboxylic acid; Signal | Metallocarboxypeptidase inhibitor precursor (MCPI) (Carboxypeptidase,inhibitor)."	--NA--	GGTFCQACWRFAGTCGPYVGRAMAIGVMAQKFTILFTILLVVIAAQDVMAQDATLTKLFQQYDPVCHKPCSTQDDCS	77	"Experimental evidence at protein level"	8353.76	8348.01	6.7	--NA--	"FUNCTION:May play a defensive role against insect attacks.TISSUE SPECIFICITY:Ovaries.DEVELOPMENTAL STAGE:Present at very high levels during anthesis in ovaries, decreases rapidly during fruit development.INDUCTION:The MCPI RNA, but not its protein, is highly induced by wounding the leaves.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin (By similarity).SIMILARITY:To potato MCPI.CAUTION:Besides the signal peptide, the N-terminal 32 AA may contain a propeptide sequence."