PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5626	MFS18_MAIZE	--NA--	"Zea mays"	Poaceae	--NA--	Signaling-peptide	"Repeat; Signal | MFS18 protein precursor."	--NA--	GGSPGFSGFGGMPGSPTAGSVPEHANKPMARSSKMMVAARLLALALAVSTAEARNIKTTTTEKKDDAVVQPQTFPPFDRLGGGASPAFGGLPGGSIPGSSIPGFSMPGSGSSLPGFSLPGSGTMPLFG	128	"Experimental evidence at transcript level"	12535.26	12527.25	9.82	--NA--	"TISSUE SPECIFICITY:Enhanced expression in male flowers.Accumulates in the glumes and in anther walls, paleas and lemmas of mature florets.DEVELOPMENTAL STAGE:Expressed throughout tassel growth up until mature pollen is produced in the anthers."