PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5615	PER1_WHEAT	--NA--	"Triticum aestivum"	Poaceae	--NA--	Signaling-peptide	"Calcium; Glycoprotein; Heme; Hydrogen peroxide; Iron; Metal-binding; Oxidoreductase; Peroxidase; Pyrrolidone carboxylic acid; Secreted; Signal | Peroxidase precursor (EC 1.11.1.7) (WP2).Secreted (By similarity)."	--NA--	GGDTNINTAFATSLKANCPQSGGNTNLANLDTMTPNAFDNAYYTNLLSQKGLLHSDQVLFNNETTDNTVRNFASNAAAFSSAFTTAMIKMGNIAPLTGTQGQIRLSCSKVNSMAMGSASCISLVVLVALATAASGQLSSTFYDTSCPRALVAIKSGVAAAVSNSDLPGPSSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYSDPRMGASLLRLHFHDCFGCDASVLLTGMEQNAGPNVGSLRGFGVIDNIKTQLESVCKQTVSCADILTVAARDSVVALGGPSWTVPLGRRDSTTASASLA	312	"Experimental evidence at transcript level"	32381.58	32361.04	8.39	--NA--	"FUNCTION:Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.FUNCTION:Involved in defense response to powdery meldew fungus.CATALYTIC ACTIVITY:Donor H(2)O(2) = oxidized donor 2 H(2)O.COFACTOR:Binds 2 calcium ions per subunit.COFACTOR:Binds 1 heme B (iron-protoporphyrin IX) group per subunit.TISSUE SPECIFICITY:Root.SIMILARITY:Belongs to the peroxidase family. Classical plant (class III) peroxidase subfamily."