PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5610	LCR75_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Plant defense; Secreted; Signal | Low-molecular-weight cysteine-rich protein LCR75 precursor.Secreted (By similarity)."	--NA--	GFTDGRCKGFTRKCICSKPCFVLPNMQLIPTLFFLTILLASPEMVEGQQMCEAKSLDWKGMCLKWRNCRQVCISE	75	"Experimental evidence at transcript level"	8581.3	8575.19	8.72	--NA--	"TISSUE SPECIFICITY:Expressed in stems, roots, rosette leaves and flower buds.SIMILARITY:Belongs to the plant defensin family."