PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5595	PSK_ASPOF	--NA--	"Asparagus officinalis"	Asparagaceae	--NA--	Signaling-peptide	"Developmental protein; Differentiation; Direct protein sequencing; Growth factor; Secreted; Signal; Sulfation | Phytosulfokines precursor [Contains: Phytosulfokine-alpha (PSK-alpha),(Phytosulfokine-a); Phytosulfokine-beta (PSK-beta) (Phytosulfokine-,b)].Secreted."	--NA--	GEEECLMRRTLTAHVDYIYTQDHNPMSSKAITLLLIALLFSLSLAQAARPLQPADSTKSVHVIPEKVHDEACEGV	75	"Experimental evidence at protein level"	8274.49	8269.21	5.38	--NA--	"FUNCTION:Promotes plant cell differentiation, organogenesis and somatic embryogenesis as well as cell proliferation.INDUCTION:Expression is regulated by a signal transduction pathway activated by auxin and cytokinin.PTM:Sulfation is important for activity and for the binding to a putative membrane receptor. Deletion of the sulfate groups of Tyr- 67 and Tyr-69 resulted in compounds with respectively 0.6% and 4% of the activity.PTM:PSK-alpha is produced by endopeptidase digestion. PSK-beta is produced from PSK-alpha by exopeptidase digestion.MISCELLANEOUS:The N-terminal tripeptide (YIY) is the active core.SIMILARITY:Belongs to the phytosulfokine family."