PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5594	NLTP1_HORVU	--NA--	"Hordeum vulgare"	Poaceae	--NA--	Signaling-peptide	"3D-structure; Direct protein sequencing; Lipid-binding; Lipoprotein; Signal; Transport | Non-specific lipid-transfer protein 1 precursor (LTP 1) (Probable,amylase/protease inhibitor)."	--NA--	GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNMARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSVNVPYTISPDIDCSRIY	117	"Experimental evidence at protein level"	12301.24	12293.07	8.71	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.TISSUE SPECIFICITY:Aleurone layer of developing and germinating seeds.BIOTECHNOLOGY:During brewing process, structural and chemical modifications of the protein occur. Both unfolding of the structure and glycation should increased the amphiphilicity of the protein, leading to foam-promoting forms that concentrate in beer foams.SIMILARITY:Belongs to the plant LTP family.CAUTION:Was originally thought to be an inhibitor of alpha- amylase or of a protease and was known asPAPI:probable alpha- amylase/protease inhibitor.SEQUENCE CAUTION:Sequence=CAA42832.1; Type=Erroneous gene model prediction;WEB RESOURCE:Name=Protein Spotlight; Note=One beer please - Issue 48 of July 2004; URL=""http://www.expasy.org/spotlight/back_issues/sptlt048.shtml""; "