PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5584	AGI_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"Chitin-binding; Direct protein sequencing; Glycoprotein; Lectin; Pyrrolidone carboxylic acid; Repeat; Signal | Lectin precursor (Agglutinin) [Contains: Lectin 10 kDa peptide; Lectin,8 kDa peptide]."	--NA--	GDGMAAILANNQSVSFEGIIESVAELVMTMTSTTTKAMAMAAAVLAAAAVAATNAQTCGKQNDGMICPHNLCCSQFGSGACCPEKRCGKQAGGDKCPNNFCCSAGGYCGLGGNYCGSGCQSGGCYKGYCGLGRDYCGTGCQSGACCSSQRCGSQGGGATCSNNQCCSQYGYCGFGSEYCGSGCQNGPCRADIKCGRNANGELCPNNMCCSQWGYCGLGSEFCGNGCQ	227	"Experimental evidence at protein level"	22795.54	22779.26	6.6	--NA--	"FUNCTION:N-acetyl-D-glucosamine binding lectin.TISSUE SPECIFICITY:Confined to root caps, several cell layers at the periphery of the coleorhiza and radicle, and in all cell layers of the coleoptile.SIMILARITY:Contains 4 chitin-binding type-1 domains."