PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5567	AGP2_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Direct protein sequencing; Glycoprotein; GPI-anchor; Hydroxylation; Lipoprotein; Membrane; Proteoglycan; Pyrrolidone carboxylic acid; Signal | Classical arabinogalactan protein 2 precursor.Cell membrane; Lipid-anchor, GPI-anchor (Potential)."	--NA--	GAADAPSAAWANKAFLVGTAVAGALYAVVLAMNSKAMQALIFLGFLATSCLAQAPAPAPTTVTPPPTALPPVTAETPSPIASPPVPVNEPTPAPTTSPTTSPVASPPQTDAPAPGPSAGLTPTSSPAPGPD	131	"Experimental evidence at protein level"	12582.33	12574.43	4.11	--NA--	"FUNCTION:Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.INDUCTION:By Al treatment.PTM:O-glycosylated on hydroxyprolines; noncontiguous hydroxylproline residues are glycosylated with arabinogalactan.SIMILARITY:Belongs to the classical AGP family."