PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5553	GL120_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Apoplast; Complete proteome; Glycoprotein; Manganese; Metal-binding; Secreted; Signal | Germin-like protein subfamily 1 member 20 precursor (GLP2a copy 2),(Germin type 2) (GLP2b) (At-GERM2) (AtGER2).Secreted, extracellular space, apoplast (By similarity)."	--NA--	FVFPIGMIHFQVNVGKIPAVAFAGLSSQNAGVITIANTVFGSNPPIYPELLARAFQLDASVVKELQAKFGSIMRVSQSLVPFAIIALVLSFVNAYDPSPLQDFCVAIDDLKGVFVNGRFCKDPKRVDAKDFFFSGLNVPGNTNNQVGSNVTTVNVDQIPGLNTMGISLVRIDYAPHGQNPPHTHPRGSEILVLVEGTLYVGFVSSNQDNNRLFAKVLHPGDV	222	"Experimental evidence at protein level"	23925.47	23910.43	6.56	--NA--	"FUNCTION:May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.SUBUNIT:Oligomer (believed to be a pentamer but probably hexamer) (By similarity).TISSUE SPECIFICITY:Expressed in stems and developing embryos.SIMILARITY:Belongs to the germin family."