PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5552	GL118_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Alternative splicing; Apoplast; Complete proteome; Glycoprotein; Manganese; Metal-binding; Secreted; Signal | Germin-like protein subfamily 1 member 18 precursor (GLP2a copy 1).Secreted, extracellular space, apoplast (By similarity)."	--NA--	FVFPIGMIHFQVNVGKIPAVAFAGLSSQNAGVITIANTVFGSNPPIYPELLARAFQLDASVVKELQAKFGSIMRVSQSLVPFAIIALVLSFVNAYDPSPLQDFCVAIDDLKGVFVNGRFCKDPKRVDAKDFFFSGLNMPGNTNNQVGSNVTTVNVDQIPGLNTMGISLVRIDYAPHGQNPPHTHPRGSEILVLVEGTLYVGFVSSNQDNNRLFAKVLHPGDV	222	"Experimental evidence at transcript level"	23957.53	23942.4	6.56	--NA--	"FUNCTION:May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.SUBUNIT:Oligomer (believed to be a pentamer but probably hexamer) (By similarity).ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=1; Comment=A number of isoforms are produced. According to EST sequences; Name=1; IsoId=P92999-1; Sequence=Displayed;SIMILARITY:Belongs to the germin family."