PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5545	XTH31_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Apoplast; Cell wall; Cell wall biogenesis/degradation; Complete proteome; Glycosidase; Hydrolase; Secreted; Signal; Transferase | Probable xyloglucan endotransglucosylase/hydrolase protein 31,precursor (EC 2.4.1.207) (At-XTH31) (XTH-31) (AtXTR8).Secreted, cell wall (Probable). Secreted, extracellular space, apoplast (Probabl"	--NA--	FTLWFDPTQDFHHYAILWNPNQIVFFVDDVPIRTYNRKNEAIFPTRPMWVHQRREQDVVTLWLDKSTGSGFKSLRPYRSGYFGASIKLQPGFTAGVDTSLMALSLIFLALLVLCPSSGHSQRSPSPGYYPSSRVPTSPFDREFRTLWGSQPAPMRNRGLSRQQMAALTWAQRNFLVYNYCHDPKRDHTQTPECYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTADSSSSCRPPSYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQTNVFVRGSGDRNVIGREMK	293	"Experimental evidence at protein level"	33540.69	33519.5	9.03	--NA--	"FUNCTION:Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity).CATALYTIC ACTIVITY:Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.TISSUE SPECIFICITY:Predominantly expressed in root. Weakly expressed in influorescence stems.DEVELOPMENTAL STAGE:Expressed in germinating seeds from 24 hours after imbibation, and reaches a maximum level at 72 hours. After 96 hours, it then decreases.INDUCTION:By gibberellins (Probable). Not induced by auxin.PTM:Contains at least one intrachain disulfide bond essential for its enzymatic activity (By similarity).MISCELLANEOUS:In contrast to group 1 and group 2 endotransglucosylase/hydrolase proteins, it may not contain the ligase activity, and may catalyze endohydrolysis xyloglucan polymers only.SIMILARITY:Belongs to the glycosyl hydrolase 16 family. XTH group 3 subfamily.WEB RESOURCE:Name=XTH-World; URL=""http://labs.plantbio.cornell.edu/XTH/""; "