PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5542	SCP54_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Glycoprotein; Secreted; Signal | Putative serine carboxypeptidase-like 54 precursor.Secreted (Potential)."	--NA--	FSYANDSTDLRHDEDSVSNDLYDFLQAFFKEHPNLAKDDFYITGESYAGHHFFFQSRNNSSDPVVIWLSGGPGCSSSNQRYISYLKISNLIYVDQPIRTGMATKTFSLPFLLIVCIFSQLSSTFGDPSVKDLGQHAGYFSLPRSKSARLFYIPALASRVHNGNEKKEGIVINLKVTDISLVTATATWSAG	190	Predicted	21153.7	21140.54	6.31	--NA--	"SIMILARITY:Belongs to the peptidase S10 family.CAUTION:Lacks the second part of the protein and the active site Asp and His residues which is a conserved feature of peptidase S10 family.CAUTION:Could be the product of a pseudogene."