PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5540	AGP17_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Alternative splicing; Complete proteome; Glycoprotein; GPI-anchor; Lipoprotein; Membrane; Proteoglycan; Pyrrolidone carboxylic acid; Signal | Lysine-rich arabinogalactan protein 17 precursor (Lys-rich AGP 17).Cell membrane; Lipid-anchor, GPI-anchor (Potential)."	--NA--	FSPAADDQSGAQRISVVIQMVGAAAIAWSLLVLAFMTRNILLTVTLICIVFITVGGQSPATAPIHSPSTSPHKPKPTSPAISPAAPSADVPAPALTKHKKKTKKHKTAPAPGPASELLSPPAPPGEAPGPGPSDAPTPESTEAPAKTPVEAPVEAPPSPTPASTPQISPPAPSPEADTPSAPEIA	185	"Experimental evidence at transcript level"	18481.14	18469.68	6.46	--NA--	"FUNCTION:Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=1; Comment=A number of isoforms are produced. According to EST sequences; Name=1; IsoId=O22194-1; Sequence=Displayed;TISSUE SPECIFICITY:Predominanlty expressed in open flowers. Also expressed in leaves and stems, and at a lower level in roots.PTM:O-glycosylated on the hydroxyproline residues (By similarity).SIMILARITY:Belongs to the lysine-rich AGP family."