PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5532	BCB1_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Copper; Electron transport; Glycoprotein; GPI-anchor; Lipoprotein; Membrane; Metal-binding; Signal; Transport | Blue copper protein precursor (Blue copper-binding protein) (AtBCB),(Stellacyanin) (Phytocyanin 1).Cell membrane; Lipid-anchor, GPI-anchor."	--NA--	FRVGDELEFDFAAGRHDVAVVSEAAFENCEKEKPISHMTVPPVKIMLNTTGPQYFICTVGDHCRFGQKLSITVVAAGATGGATPGAGATPAPGSTPSTGGMAGVFKTVTFLVLVFAAVVVFAEDYDVGDDTEWTRPMDPEFYTTWATGKTTTPPTAGGTTTPSGSSGTTTPAGNAASSLGGATFLVAFVSAVVALF	196	"Experimental evidence at transcript level"	20053.55	20040.82	4.68	--NA--	"FUNCTION:Probably acts as an electron carrier.DEVELOPMENTAL STAGE:Maximum levels are found in 35 day old plantlets when the rosette is mature, consisting of 8-10 fully expanded leaves, and as the floral stem starts to form. This level remains constant during the further life span of the plant.INDUCTION:By dark adaptation. This gives a 20-fold increase in expression.SIMILARITY:Contains 1 plastocyanin-like domain."