PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5517	2SSB_BRANA	--NA--	"Brassica napus"	Brassicaceae	--NA--	Signaling-peptide	"Seed storage protein; Signal; Storage protein | Napin-B precursor (1.7S seed storage protein) [Contains: Napin-B small,chain; Napin-B large chain]."	--NA--	FQQAQHLKACQQWLHKQAMQSGSGPSWTLDGEFDFEDDMENPQGPQQRPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQIQQQGQQQGKLQMVSRIYQMANKLFLVSATLAFFFLLTNASIYRTVVEFDEDDATNPAGPFRIPKCRKETATHLPKVCKIPQVSVCPFQKTMPGPSY	178	"Experimental evidence at transcript level"	20114.04	20100.9	7.71	--NA--	"FUNCTION:The small, basic, water-soluble napins are one of the two major kinds of storage proteins synthesized in the seed during its maturation.SUBUNIT:The mature protein consists of a small and a large chain linked by disulfide bonds.TISSUE SPECIFICITY:Cotyledons and the axis.SIMILARITY:Belongs to the 2S seed storage albumins family."
