PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5491	PSAF_GUITH	--NA--	"Guillardia theta, Cryptomonas"	"Geminigeraceae, Cryptomonadaceae"	--NA--	Signaling-peptide	"Chloroplast; Membrane; Photosynthesis; Photosystem I; Plastid; Signal; Thylakoid; Transmembrane | Photosystem I reaction center subunit III precursor (PSI-F).Plastid, chloroplast thylakoid lumen."	--NA--	FISTGYIWPFAAFKEFTSGNLIAKEDEITVSPRHAGEFMVPGLFFLYIAGWIGWVGRNYVQFASQTDKPTEKEIIIDVPVALSLSKYEPNTPPYLALETQINKTKNRFTQYGNAGLLCGTDGLPHLIADGRWSMKNRIIIFIIGLFCLQPVASHADVAGLVPCKNSKEFQRRLDSSVKKLESR	183	"Protein inferred from homology"	20516.7	20503.67	8.75	--NA--	"FUNCTION:Probably participates in efficiency of electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). This plastocyanin-docking protein contributes to the specific association of plastocyanin to PSI.SIMILARITY:Belongs to the psaF family."