PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5473	TLP2_PRUPE	--NA--	"Prunus persica"	Rosaceae	--NA--	Signaling-peptide	"Plant defense; Secreted; Signal | Thaumatin-like protein 2 precursor (PpAZ8).Secreted (Potential)."	--NA--	FELASQASFQLDTPVPWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDFYDVSLVDGFNLPMSVTPQGGTGTCKMGMMKTLGAVLSLSLTLLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITFCPSCAANVNLVCPSELQKIGSDGSVVACLSACVKFGEPQYCCTPPQETKEKC	242	"Experimental evidence at transcript level"	25607.98	25590.86	4.81	--NA--	"FUNCTION:May be involved in protecting plant tissues from pathogen infection.TISSUE SPECIFICITY:Preferentially expressed in the abscission zone of fruit. Also expressed in leaf abscission zone.DEVELOPMENTAL STAGE:Expressed during leaf senescence but not during fruit ripening.INDUCTION:Up-regulated in the abscission zone following treatment with propylene and in both the abscission zone and surrounding tissues after wounding due to embryoctomy.SIMILARITY:Belongs to the thaumatin family."