PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5467	LCR21_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Signal | Low-molecular-weight cysteine-rich protein LCR21 precursor."	--NA--	FEEYNGGGTCIASKTGRTTNCMCTYNCHGNNLMAKISCSYFLVLMLVFSVFSLVEKTKGKRHCSTIILPESPCVPQDCVEYC	82	"Experimental evidence at transcript level"	9087.59	9081.22	7.67	--NA--	"TISSUE SPECIFICITY:Expressed in flower buds, but not in stems, roots or rosette leaves.SIMILARITY:Belongs to the LCR protein family."