PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5465	RNS3_PETHY	--NA--	"Petunia hybrida"	Solanaceae	--NA--	Signaling-peptide	"Endonuclease; Glycoprotein; Hydrolase; Nuclease; Secreted; Signal | Ribonuclease S-3 precursor (EC 3.1.27.1) (Stylar glycoprotein 3) (S3-,RNase).Secreted, extracellular space."	--NA--	FDRCRHSNTCDETSSTKILFRGFTIHGLWPEKKRFRLEFCTGDKYKRFLEEDNIINVLERHWIQMRFDETYAMFRLQLISAFFILLFSLSPVSANFDYFQLVLTWPASFCYPKNKCQRRSNNNTKQPLWEHEYNRHGICCKNLYDQKAYFLLAMRLKDKLDLLTTLRTHGITPGTKHTFGEIQKAIKTVTSNNDPDLKCVENIKGVMELNEIGICYTPAADR	222	"Protein inferred from homology"	26213.19	26196.21	8.92	--NA--	"FUNCTION:Self-incompatibility (SI) is the inherited ability of a flowering plant to prevent self-fertilization by discriminating between self and non-self pollen during pollination. In many species, self-incompatibility is controlled by the single, multiallelic locus S.CATALYTIC ACTIVITY:Two-stage endonucleolytic cleavage to nucleoside 3'-phosphates and 3'-phosphooligonucleotides with 2',3'-cyclic phosphate intermediates.SIMILARITY:Belongs to the RNase T2 family."
