PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5452	LEC5_DOLBI	--NA--	"Dolichos biflorus"	Fabaceae	--NA--	Signaling-peptide	"3D-structure; Calcium; Direct protein sequencing; Glycoprotein; Lectin; Signal | Lectin DB58 precursor [Contains: Lectin DB58 subunit alpha; Lectin,DB58 subunit beta]."	--NA--	FASKLPDDSTTEPLDIASYLVRNVLLRLTKVKGNGLPTLSSLGRAFYSSPIQIYDKSTGAVASWATSFTANIFAPLVHPSRRTSYIVSERVDITNELPEYVSIGFSATTGLSEGYTETHDVLSWSMASSTVSVVLSLFLLLLTQAYSADIQSFSFKNFNSSSFILQGDATVSSSKNKSSSADGIAFALVPVGSEPKSNSGFLGVFDSDVYDNSAQTVAVEFDTFSNTDWDPTSRHIGIDVNSIKSIRTASWGLANGQNAEILITYNAATSLLVAS	275	"Experimental evidence at protein level"	29452.81	29434.85	4.81	--NA--	"FUNCTION:Metalloglycoprotein, containing Ca, Mg, Mn, and Zn and the carbohydrates galactose, glucosamine, mannose, and fucose. It agglutinates erythrocytes of blood group A1.SUBUNIT:Heterodimer, composed of an alpha and a beta subunit derived from a single precursor.PTM:Leu-264 is missing in a major portion of the beta subunit, suggesting an origin by sequential removal of amino acids rather than a processing by endoproteolytic cleavage.SIMILARITY:Belongs to the leguminous lectin family."