PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5450	NEP1_NEPGR	--NA--	"Nepenthes gracilis"	Nepenthaceae	--NA--	Signaling-peptide	"Aspartyl protease; Glycoprotein; Hydrolase; Polymorphism; Protease; Secreted; Signal; Zymogen | Aspartic proteinase nepenthesin-1 precursor (EC 3.4.23.12),(Nepenthesin-I).Secreted (By similarity)."	--NA--	FALNSNNGTGGIIIDSGTTLTYFVNNAYQSVRQEFISQINLPVVNGSSSGFDLCFQTPSDPSNLQIPTFVMHFDGGDLELPSENYFISPSNGLICLAMGSFGCGENNQGFGQGNGAGLVGMGRGPLSLPSQLDVTKFSYCMTPIGSSTPSGKNLTKFQLLERAIERGSRRLQRLEAMLNGPSGVETSVYAGDGEYLMNLSIGTPAQPFSAIMDTGSDLIWTQCQPCTQCFNQSTPIFNPQGSSSFSTLPCMASSLYSFLLALSIVYIFVAPTHSTSRTALNHRHEAKVTGFQIMLEHVDSNLLLGSLANSVTAGSPNTTLIQSSQIPTFYYITLNGLSVGSTRLPIDPSASSQGMSIFGNIQQQNMLVVYDTGNSVVSFASAQCGASSSQLCQALSSPTCSNNFCQYTYGYGDGSETQGSMGTETLTFGSVSIPNIT	437	"Experimental evidence at protein level"	46356.92	46327.24	4.69	--NA--	"FUNCTION:Extracellular proteinase found in the pitcher fluid of carnivorous plants. Digest prey for nitrogen uptake.CATALYTIC ACTIVITY:Similar to pepsin, but also cleaves on either side of Asp and at Lys-|-Arg.ENZYME REGULATION:Inhibited by pepstatin and by diazoacetyl-D,L- norleucine methyl ester (DAN) in the presence of Cu(2) ions (By similarity).BIOPHYSICOCHEMICAL PROPERTIES:pH dependence: Optimum pH is 2.6. Retains 95% and 79% of the original activity after incubation for 30 days at pH 3.0 and pH 10.0 respectively; Temperature dependence: Optimum temperature is 55 degrees Celsius. Thermostable up to 50 degrees Celsius. Retains 60% of the original activity after incubation for 30 days at 50 degrees Celsius;SIMILARITY:Belongs to the peptidase A1 family."