PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5408	CY550_GRATL	--NA--	"Gracilaria tenuistipitata var. liui"	Gracilariaceae	--NA--	Signaling-peptide	"Chloroplast; Electron transport; Heme; Iron; Membrane; Metal-binding; Photosynthesis; Photosystem II; Plastid; Signal; Thylakoid; Transport | Cytochrome c-550 precursor (Cytochrome c550).Plastid, chloroplast thylakoid membrane; Peripheral membrane protein; Lumenal si"	--NA--	EQVKRGKRLFNNSCAQCHNGGITKTNPNIGLDPESLSGATPVRDNIRNLIEYIKDPTSYDGATSIAELHPSIKSAEIFPKMRNLTDEDLFAIAGHILIQPKIAAEKWGGGKIYYMIPNRKIQLSLFAVIIVFETLLNQVYAMELDEATRTVTLEESGKTITLTP	164	"Protein inferred from homology"	18188.89	18177.49	6.37	--NA--	"FUNCTION:Low-potential cytochrome c that plays a role in the oxygen-evolving complex of photosystem II (By similarity).COFACTOR:Binds 1 heme group covalently per subunit (By similarity).SUBUNIT:The oxygen-evolving complex in red algae is composed of psbO (OEC33), psbQ', cytochrome c-550 and psbU (By similarity).SIMILARITY:Belongs to the cytochrome c family. PsbV subfamily."