PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5401	PRR2_TOBAC	--NA--	"Nicotiana tabacum"	Solanaceae	--NA--	Signaling-peptide	"Pathogenesis-related protein; Plant defense; Signal; Vacuole | Pathogenesis-related protein R minor form precursor (PR-R) (PROB12),(Thaumatin-like protein E2).Vacuole."	--NA--	EQCPAQLKTQGGCNNPCTVIKTNEFCCTNGPGSCGPTDLSRFFKARCPDAKPPNTLAEFALNQPNQDFVDISLVDGFNIPMEFSPTNGGCRNLRCTAPINMNFLKSFPFYAFLCFGQYFVAVTHAATFDIVNQCTYTVWAAASPGGGRQLNSGQSWSINVNPGTVQARIWGRTNCNFDGSGRGNCETGDCNGMLECQGYGYSYPQDDPPSLFTCPPGTNYRVVFCP	226	"Experimental evidence at transcript level"	24551.54	24535.23	5.34	--NA--	"MISCELLANEOUS:PR proteins are acid-soluble, protease-resistant proteins which accumulate in the intercellular spaces of many plants as a result of the hypersensitive reaction to a pathogen.MISCELLANEOUS:PR-R exists as two isoforms in tobacco, a major and a minor form.SIMILARITY:Belongs to the thaumatin family."