PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5395	PR1B_TOBAC	--NA--	"Nicotiana tabacum"	Solanaceae	--NA--	Signaling-peptide	"Pathogenesis-related protein; Plant defense; Signal; Vacuole | Pathogenesis-related protein 1B precursor (PR-1B).Vacuole. Note=Accumulates in within the vacuoles of specialized cells known as c"	--NA--	EPLTWDNGVAAYAQNYVSQLAADCNLVHSHGQYGENLAQGSGDFMTAAKAMGFFLFSQMPSFFLVSTLLLFLIISHSSHAQNSQQDYLDAHNTARADVGVVEMWVDEKQYYDHDSNTCAQGQVCGHYTQVVWRNSVRVGCARVKCNNGGYVVSCNYDPPGNVIGQSPY	168	"Experimental evidence at transcript level"	18499.51	18487.59	5.26	--NA--	"FUNCTION:Probably involved in the defense reaction of plants against pathogens.INDUCTION:Synthesized during pathogen infection or other stress- related responses.PTM:Three disulfide bonds are present (By similarity).SIMILARITY:Belongs to the CRISP family."
