PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5393	PR1A_TOBAC	--NA--	"Nicotiana tabacum"	Solanaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Pathogenesis-related protein; Plant defense; Signal; Vacuole | Pathogenesis-related protein 1A precursor (PR-1A).Vacuole. Note=Accumulates in within the vacuoles of specialized cells known as c"	--NA--	EPLTWDDQVAAYAQNYASQLAADCNLVHSHGQYGENLAEGSGDFMTAAKAMGFVLFSQLPSFLLVSTLLLFLVISHSCRAQNSQQDYLDAHNTARADVGVVEMWVDEKQYYDHDSNTCAQGQVCGHYTQVVWRNSVRVGCARVQCNNGGYVVSCNYDPPGNYRGESPY	168	"Experimental evidence at protein level"	18573.5	18561.59	4.83	--NA--	"FUNCTION:Probably involved in the defense reaction of plants against pathogens.INDUCTION:Synthesized during pathogen infection or other stress- related responses.PTM:Three disulfide bonds are present (By similarity).SIMILARITY:Belongs to the CRISP family."