PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5381	GRC14_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"Electron transport; Redox-active center; Secreted; Signal; Transport | Putative glutaredoxin-C14 precursor.Secreted (Potential)."	--NA--	EMERALLKLLGRGPPVPVVFIGGKLVGGTNKIMSLHLGGELIPMLKNAGALWLMDRVMKLASERAVVIFTLSSCCMCHTVTRLFCDLGVNALVHELDQDPRGK	103	"Protein inferred from homology"	11199.47	11191.93	8.85	--NA--	"FUNCTION:Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins (By similarity).SIMILARITY:Belongs to the glutaredoxin family.SIMILARITY:Contains 1 glutaredoxin domain.SEQUENCE CAUTION:Sequence=BAF29961.1; Type=Erroneous gene model prediction; "
