PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5376	CP20A_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Chaperone; Complete proteome; Cyclosporin; Endoplasmic reticulum; Isomerase; Rotamase; Secreted; Signal | Peptidyl-prolyl cis-trans isomerase CYP20-1 precursor (EC 5.2.1.8),(PPIase CYP20-1) (Rotamase cyclophilin-7) (Cyclophilin of 20 kDa 1).Endoplasmic reticulum (By similarity)."	--NA--	ELPLFITTVTTSWLDGRHVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGIVMGLFGKTVPKTVENFRALCTGEKGIGKNGKALHYKGSSFHRIIPSFMLMASSVTLLLWSLLLLGTLSAIQAKKSKENLKEITHKVYFDVEIDGKAAGRQGGDFTHGNGMGGESIYGEKFADENFKLKHTGPGFLSMANAGQDTNGSQF	204	"Experimental evidence at protein level"	21961.25	21947.34	9.08	--NA--	"FUNCTION:PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Seems to be involved in root development.CATALYTIC ACTIVITY:Peptidylproline (omega=180) = peptidylproline (omega=0).ENZYME REGULATION:Binds cyclosporin A (CsA). CsA mediates some of its effects via an inhibitory action on PPIase (By similarity).SUBUNIT:Interacts with the PP2A A subunit PP2AA1/RCN1.Secreted (By similarity).TISSUE SPECIFICITY:Ubiquitous, mostly in aerial organs. Higher levels in leaf and buds, and lower levels in seedlings.SIMILARITY:Belongs to the cyclophilin-type PPIase family.SIMILARITY:Contains 1 PPIase cyclophilin-type domain."