PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5374	IAAB_HORVU	--NA--	"Hordeum vulgare"	Poaceae	--NA--	Signaling-peptide	"Allergen; Alpha-amylase inhibitor; Direct protein sequencing; Glycoprotein; Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Alpha-amylase/trypsin inhibitor CMb precursor (Chloroform/methanol-,soluble protein CMb).Secreted."	--NA--	ELPGCPREVQMDFVRILVTPGFCNLTTVHNTPYCLAMDEWQWNRQFCSSMASKSSCDLLLAAVLVSIFAAVAAVGSEDCTPWTATPITPLPSCRDYVEQQACRIETPGPPYLAKQQCCGELANIPQQCRCQALRFFMGRKSRPDQSGLM	149	"Experimental evidence at protein level"	16526.11	16514.89	5.79	--NA--	"FUNCTION:Part of a complex with inhibitory activity, but CMb is inactive as a separate subunit.SUBUNIT:Heterotetramer of one CMa, one CMb and two CMd chains.TISSUE SPECIFICITY:Endosperm.PTM:Five disulfide bonds are present (Probable), which are essential for the inhibitor activity.PTM:Exists both in a glycosylated and in a unglycosylated form.The glycosylated form is a potent allergen.ALLERGEN:Causes an allergic reaction in human. Involved in baker's asthma.SIMILARITY:Belongs to the protease inhibitor I6 (cereal trypsin/alpha-amylase inhibitor) family."