PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5359	DEF_NICAL	--NA--	"Nicotiana alata"	Solanaceae	--NA--	Signaling-peptide	"Antimicrobial; Direct protein sequencing; Fungicide; Plant defense; Signal; Vacuole | Flower-specific defensin precursor (NaD1).Vacuole."	--NA--	EIMDNMARSLCFMAFAILAMMLFVAYEVQARECKTESNTFPGICITKPPCRKACISEKFTDGHCSKILRRCLCTKPCVFDEKMTKTGAEILAEEAKTLAAALLEE	105	"Experimental evidence at protein level"	11721.92	11713.74	6.82	--NA--	"FUNCTION:Plant defense peptide with antifungal activity against F.oxysporum and B.cinerea. Retards the growth of the Lepidopteran insect pests H.armigera and H.punctigera.BIOPHYSICOCHEMICAL PROPERTIES:pH dependence: Stable under extremes of pH; Temperature dependence: Stable under extremes of temperature;TISSUE SPECIFICITY:Most abundant in the epidermal cell layers of the petals and sepals, within the connective cells of the anthers, and the cortical cells of the style. Not detected in the tapetum, pollen mother cells, the transmitting tissue, the vascular bundles of the anther and style or in leaves. Expressed also in ovaries, but barley detectable in roots.SIMILARITY:Belongs to the plant defensin family."