PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5329	CYT9_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"Plant defense; Protease inhibitor; Secreted; Signal; Thiol protease inhibitor | Putative cysteine proteinase inhibitor 9 precursor (Oryzacystatin-9),(Oryzacystatin IX) (OC-IX).Secreted (Potential)."	--NA--	EGDEHKLVSFVPIHMRTSSLVLFAAVAVFGAACTAAAGDESWKTIDANDRHVQDVALWAVAETDWASATGGLTLNTVDGAEKRFEAGVNYYRLTLEASSRVVAKYLRFQAVVYE	114	"Protein inferred from homology"	12395.91	12388.23	5.04	--NA--	"FUNCTION:Specific inhibitor of cysteine proteinases. Probably involved in the regulation of endogenous processes and in defense against pests and pathogens (By similarity).SIMILARITY:Belongs to the cystatin family. Phytocystatin subfamily."
