PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5319	XTH9_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Alternative splicing; Apoplast; Cell wall; Cell wall biogenesis/degradation; Complete proteome; Glycoprotein; Glycosidase; Hydrolase; Secreted; Signal; Transferase | Xyloglucan endotransglucosylase/hydrolase protein 9 precursor,(EC 2.4.1.207) (At-XTH9) (XTH-9).Secreted, cell wall (Probable). Secreted, extracellular space, apoplast (Probabl"	--NA--	EFDFEFLGNTTGEPYIVQTNIYVNGVGNREQRLNLWFDPTTEFHTYSILWLKLDNYSGAGFESRSKYLFGKVSIQIKLVEGDSAGTVTAFYMSSDGPNHNLVKTDWSHAPFVASYKEFQIDACEIPTTTDLSKCNGDQKFWWDEPTVSELMVGMDLFKCVMMIMVLVVSCGEAVSGAKFDELYRSSWAMDHCVNEGEVTKSKRSVVFMVDETPIRVQKNLEEKGIPFAKDQAMGVYSSIWNADDWATQGGSLHQNHQLIWVRANHMIYDYCFDATRFPVTPLECQHHRHL	290	"Experimental evidence at transcript level"	33141.4	33119.9	5.09	--NA--	"FUNCTION:Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.Involved in internodal cell elongation.CATALYTIC ACTIVITY:Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=1; Comment=A number of isoforms are produced. According to EST sequences; Name=1; IsoId=Q8LDW9-1; Sequence=Displayed;TISSUE SPECIFICITY:Highly expressed in shoot apices. In the vegetative and reproductive phases, it accumulates in the shoot apex region, where cell division is most active. In the reproductive phase, it is also expressed in flower buds, flower stalks and internodes bearing flowers.PTM:Contains at least one intrachain disulfide bond essential for its enzymatic activity (By similarity).SIMILARITY:Belongs to the glycosyl hydrolase 16 family. XTH group 1 subfamily.WEB RESOURCE:Name=XTH-World; URL=""http://labs.plantbio.cornell.edu/XTH/""; "