PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5299	PER26_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Calcium; Complete proteome; Glycoprotein; Heme; Iron; Metal-binding; Oxidoreductase; Peroxidase; Secreted; Signal | Probable peroxidase 26 precursor (EC 1.11.1.7) (Atperox P26) (ATP50).Secreted (By similarity)."	--NA--	EDFRKSFALSMSKMGAINVLTKTEGEIRKDCRHINFTGRRDGLTSDKQTVDLPSPSISWDQAMSYFKSRGLNVLDMATLLGSHSMGRTHCSYVVDRLYNYNKTGKPSPTMNKYFLSEMAKQCPPRTRKGQTDPLVMVMIHIFLTVMVVGGVSLFPETAEAIVMGPSMQKLTWHYYKVYNTCENAENFVRHQVEIFYKNDKSIAPKLLRLLYSDCFVSGCDASVLLEGPNSEKMAPQNRGLGGFVLIDKIKIVLEQRCPGVVSCADILNLATRDAVHLAGAPSYPVYLNPDSGSNHSFTSSFYSRILSNKSVLEVDQQLLYNDDTKQISKEFSEGF	335	"Experimental evidence at transcript level"	37568.08	37543.77	8.52	--NA--	"FUNCTION:Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress (Probable). The enzyme activity has to be proved.CATALYTIC ACTIVITY:Donor H(2)O(2) = oxidized donor 2 H(2)O.COFACTOR:Binds 1 heme B (iron-protoporphyrin IX) group per subunit (By similarity).COFACTOR:Binds 2 calcium ions per subunit (By similarity).MISCELLANEOUS:There are 73 peroxidase genes in A.thaliana.SIMILARITY:Belongs to the peroxidase family. Classical plant (class III) peroxidase subfamily.CAUTION:Lacks the distal histidine (here Ser-77), present in the active site, which is one of the conserved features of the classical plant (class III) peroxidase family."