PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5292	GASA4_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Secreted; Signal | Gibberellin-regulated protein 4 precursor.Secreted."	--NA--	ECDRRCKKTQYHKACITFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCPMAKSYGAIFLLTLIVLFMLQTMVMASSGSNVKWSQKRYGPGSLKRTQCPS	106	"Experimental evidence at protein level"	11996.2	11987.77	9.47	--NA--	"TISSUE SPECIFICITY:Developing roots and flower buds.INDUCTION:By gibberellins.PTM:Six disulfide bonds may be present.SIMILARITY:Belongs to the GAST1 family."