PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5290	NO24_SOYBN	--NA--	"Glycine max"	Fabaceae	--NA--	Signaling-peptide	"Membrane; Nodulation; Repeat; Signal | Nodulin 24 precursor (N-24).Symbiosome, peribacteroid membrane."	--NA--	EAVQETNEVADTKLVGAGEAVQETNEVADTKLVGAGGVVKQRNKVGYGKLMGSKMAILILGLLAMLLLITSEVAARNLKEAGEAVQETNEVADAKLVAAGVGVGGYDYGNWNGGQRSPYGTGAICMRGCCFPSSLGGSVSCCPHEWQ	147	"Experimental evidence at transcript level"	15177.27	15167.54	5	--NA--	"Note=Integral part of the peribacteroid membrane, a compartment essential for effective symbiotic nitrogen fixation.INDUCTION:During nodulation in legume roots after Rhizobium infection."