PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5286	CYF_CHAVU	--NA--	"Chara vulgaris"	Characeae	--NA--	Signaling-peptide	"Chloroplast; Electron transport; Heme; Iron; Membrane; Metal-binding; Photosynthesis; Plastid; Signal; Thylakoid; Transmembrane; Transport | Apocytochrome f precursor.Plastid, chloroplast thylakoid membrane; Single-pass membrane protein (By simila"	--NA--	EATGRIVCANCHLAKKTVDIEVPQAVLPNTVFEAVVKIPYDMQLKQVLANGKKGNLNVAAVLILPEGFELAPPDRISPDIKEKIGNLSFQSYSPDQKNILMQNTNTLNWINKLIYLSISIPIFFLILVTTYPNSVEAYPVFAQQAYKSPRQVFLVLKKKQFEKVQIAEMNFSKSNNTIYSSSAEGQVVKIIRKEKGGYEIFIDTIDGRKITDIIPPGPEIIVSEGEFVKVDQPLTNNPNVGGFGQANTEIVLQNPLRMEGLILFFISVILAVVGPVPGKKYSEITFPILSPDPSINKQTNFLKYPIYVGGNRGRGQIYLDG	321	"Protein inferred from homology"	35616.39	35594.03	8.82	--NA--	"FUNCTION:Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions (By similarity).SUBUNIT:The 4 large subunits of the cytochrome b6-f complex are cytochrome b6, subunit IV (17 kDa polypeptide, petD), cytochrome f and the Rieske protein, while the 4 small subunits are petG, petL, petM and petN. The complex functions as a dimer (By similarity).SIMILARITY:Belongs to the cytochrome f family."
