PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5270	LCB2_ROBPS	--NA--	"Robinia pseudoacacia"	Fabaceae	--NA--	Signaling-peptide	"Calcium; Direct protein sequencing; Glycoprotein; Lectin; Manganese; Metal-binding; Signal | Bark agglutinin I polypeptide B precursor (RPbAI) (LECRPA2)."	--NA--	DYVQTNDVLSWSFESNLPGGNSVASVKNAGLSTYAAFQSDALVTSKGVLQLTTVNDGRPVYDSIGRVLYAAPFQIWDSTTGNVASFMASYKFKTQNSFLLLLSISFFFLLLLNKVNSTGSLSFSFPKFKHSQPDLINQIVAVEFDTFRNVAWDPNGIHMGIDVNSIQSVRTVRWDWANGEVANVFISYEASTKSLTASLVYPSLEKSFILSAIVDLKKVLPEWVRVGFTATTGLSEVTSFSFIIKAPNEGKTADGLVFFLAPVGSTQPLKGGGLLGLFKDESYNKS	286	"Experimental evidence at protein level"	31211.45	31192.08	6.18	--NA--	"FUNCTION:Bark lectins are storage proteins that probably maintain stocks of nitrogen during dormant period. Self-aggregatable molecules that can bind their own carbohydrate side chains. They could also play a role in the plant's defense against phytophagous invertebrates or herbivorous higher animals.SUBUNIT:RPbAI is composed of two polypeptides, A and B, that associate into five different tetrameric isolectins. The A4 combination is the only one devoid of agglutination activity.Isoform B4 displays maximal agglutination activity.TISSUE SPECIFICITY:Mostly in the axial and ray parenchymal cells of the inner bark. Fewer in the axial and ray parenchymal cells of the xylem. Strong expression in bark. The lectin accumulates in the inner bark in autumn and winter and disappears in may.SIMILARITY:Belongs to the leguminous lectin family."