PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5269	HINB2_HORVU	--NA--	"Hordeum vulgare"	Poaceae	--NA--	Signaling-peptide	"Antibiotic; Antimicrobial; Direct protein sequencing; Membrane; Plant defense; Polymorphism; Secreted; Signal; Toxin | Hordoindoline-B2 precursor (Puroindoline-B).Membrane (By similarity). Secreted, extracellular space (By similarity)."	--NA--	DYVMERCFTMKDFPVTWPTKWWKGGCEHEVREKCCQQLSQIAPHCRCDAIMKTLFLLALLALVASTTSAQYSVGGGYNDVGGGGGSQQCPQERPNLGSCKRGVIQGKLGGIFGIGGGAVFKQIQRAQILPSKCNMGVDCRFPSGYYW	147	"Experimental evidence at protein level"	16077.59	16066.81	8.85	--NA--	"FUNCTION:Acts as a membranotoxin, probably through its antibacterial and antifungal activities, contributing to the defense mechanism of the plant against predators. Forms monovalent cation-selective ion channels in membranes (By similarity).Contributes to grain texture and hardness.TISSUE SPECIFICITY:Found in endosperm and aleurone layer of developing kernels, but not in the embryo.PTM:Five disulfide bonds are present (By similarity)."
