PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5252	XTH22_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Apoplast; Cell wall; Cell wall biogenesis/degradation; Complete proteome; Glycoprotein; Glycosidase; Hydrolase; Secreted; Signal; Transferase | Xyloglucan endotransglucosylase/hydrolase protein 22 precursor,(EC 2.4.1.207) (At-XTH22) (XTH-22) (Touch protein 4).Secreted, cell wall (Probable). Secreted, extracellular space, apoplast (Probabl"	--NA--	DWSKAPFTASYRGFQQEACVWSNGKSSCPNASKQGTTTGSWLSQELDSTAEFLGNSSGEPYTLHTNVYTQGKGDKEQQFKLWFDPTANFHTYTILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKTKSSGSGFQSKNEYLFGKVSMQMKLVPGNSAGTVTTLYLKSPGTTWDEIDFMAITYLLPLFLSLIITSSVSANFQRDVEITWGDGRGQIKNNGELLTLSLDQQRMRWVQRNYMIYNYCTDAKRFPQGLPKECLAA	284	"Experimental evidence at protein level"	32093.24	32072.79	8.76	--NA--	"FUNCTION:Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.Its induction in case of mechanical stress, suggests that it may contribute in the adaptive changes in morphogenesis by being recruited to alter tissues tensil strength, or flexibility, enabling adaptation to mechanically stresssul environments.CATALYTIC ACTIVITY:Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.BIOPHYSICOCHEMICAL PROPERTIES:pH dependence: Optimum pH is 6.0-6.5; Temperature dependence: Optimum temperature from 12 to 18 degrees Celsius. Cold tolerant;TISSUE SPECIFICITY:Highly expressed. Predominantly expressed in green siliques. Expressed in young expanding leaves, trichomes, lateral root primordia, vascular tissue, abscission zones and elongating hypocols. Following wind stimulation, it decreases in the leaves of wind-stimulated plants, while it strongly increases in sites around cells of the pith parenchyma, between the vascular elements, and within the epidermis.INDUCTION:In response to mechanical perturbations such as wind or touch. Induced by auxin and brassinolide.PTM:Contains at least one intrachain disulfide bond essential for its enzymatic activity.PTM:N-glycosylated; essential for its enzymatic activity.SIMILARITY:Belongs to the glycosyl hydrolase 16 family. XTH group 2 subfamily.WEB RESOURCE:Name=XTH-World; URL=""http://labs.plantbio.cornell.edu/XTH/""; "