PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5247	XTH_BRAOB	--NA--	"Brassica oleracea var. botrytis"	Brassicaceae	--NA--	Signaling-peptide	"Apoplast; Cell wall; Cell wall biogenesis/degradation; Direct protein sequencing; Glycoprotein; Glycosidase; Hydrolase; Secreted; Signal; Transferase | Xyloglucan endotransglucosylase/hydrolase precursor (EC 2.4.1.207),(BobXET16A).Secreted, cell wall (Probable). Secreted, extracellular space, apoplast (Probabl"	--NA--	DWATRGGLEKTNWANAPFIASYRGFHIDGCQASVEAKYCATQGRMWWDQNEFRDLDAEQYRRLKWVRMKWTIYNYCTDRTRFPVMPAECRRDRDVHTYSVLWNLYQIVFFVDNIPIRVFKNAKDLGVRFPFNQPMKLYSSLWNADMAVSSTPWALVALFLMASSTVMAIPPRKAIDVPFGRNYVPTWAFDHQKQLNGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDTAGVVTAFYLSSTNNEHDEIDFEFLGNRTGQPVILQTNVFTGGKGNREQRIYLWFDPSKAY	295	"Experimental evidence at protein level"	34104.76	34082.91	8.93	--NA--	"FUNCTION:Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.CATALYTIC ACTIVITY:Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.PTM:Contains at least one intrachain disulfide bond essential for its enzymatic activity (By similarity).PTM:The N-glycan consists of an (GlcNAc)2(Hex)6 oligosaccharide; not essential for its enzymatic activity.MASS SPECTROMETRY:Mass=33115; Method=Electrospray; Range=24-295; Source=PubMed:12826015;MISCELLANEOUS:No hydrolytic activity detected in vitro.SIMILARITY:Belongs to the glycosyl hydrolase 16 family. XTH group 1 subfamily."