PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5222	2SS1_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Direct protein sequencing; Seed storage protein; Signal; Storage protein | 2S seed storage protein 1 precursor (2S albumin storage protein),(NWMU2-2S albumin 1) [Contains: 2S seed storage protein 1 small,subunit; 2S seed storage protein 1 large subunit]."	--NA--	DVCPFNIPSFPSFYLRQEEPDCVCPTLKQAAKAVRLQGQHQPMQVRKIYQTAKHLPNVCDIPQVMANKLFLVCAALALCFLLTNASIYRTVVEFEEDDATNPIGPKMRKCRKEFQKEQHLRACQQLMLQQARQGRSDEFDFEDDMENPQGQQQEQQLFQQCCNE	164	"Experimental evidence at protein level"	19013.75	19001.21	5.64	--NA--	"FUNCTION:This is a 2S seed storage protein.SUBUNIT:The mature protein consists of a small and a large chain linked by disulfide bonds.MISCELLANEOUS:This is the most abundant isoform of 2S albumin in Arabidopsis.SIMILARITY:Belongs to the 2S seed storage albumins family."