PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5196	API8_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Aspartic protease inhibitor; Protease inhibitor; Serine protease inhibitor; Signal; Vacuole | Aspartic protease inhibitor 8 precursor (pi8) (PI-8) (API) (API-8),(Cathepsin D inhibitor).Vacuole (By similarity)."	--NA--	DSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFGKRRLALVNENPLDVLFQEVIGQADSSYFKIVKLSNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNIPLSGGIFEDQLLNIQFNIPTVKLCVSYTIWKVGNLNAYFRTMLLETGGTMMKCLFLLCLCLLPIVVFSSTFTSQNLIDLPSESPLPKPVLDTNGKELNP	220	"Experimental evidence at transcript level"	24190.11	24174.36	6.44	--NA--	"FUNCTION:Inhibitor of cathepsin D (aspartic protease) and trypsin (serine protease). May protect the plant by inhibiting proteases of invading organisms.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family."