PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5187	PRR1_TOBAC	--NA--	"Nicotiana tabacum"	Solanaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Pathogenesis-related protein; Plant defense; Signal; Vacuole | Pathogenesis-related protein R major form precursor (Thaumatin-like,protein E22).Vacuole."	--NA--	DSGQSWSINVNPGTVQARIWGRTNCNFDGSGRGNCETGDCNGMLECQGYGEQCPAQLKTQGGCNNPCTVIKTNEYCCTNGPGSCGPTDLSRFFKERCPDAKAPNTLAEFALNQPNQDFVDISLVDGFNIPMEFSPTNGGCRNLRCTAPINMNFLKSFPFFAFLYFGQYFVAVTHAATFDIVNKCTYTVWAAASPGGGRRLYSYPQDDPTSLFTCPSGTNYRVVFCP	226	"Experimental evidence at protein level"	24666.61	24650.32	5.39	--NA--	"MISCELLANEOUS:PR proteins are acid-soluble, protease-resistant proteins which accumulate in the intercellular spaces of many plants as a result of the hypersensitive reaction to a pathogen.MISCELLANEOUS:PR-R exists as two isoforms in tobacco, a major and a minor form.SIMILARITY:Belongs to the thaumatin family."