PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5158	RNS4_PYRPY	--NA--	"Pyrus pyrifolia, Pyrus serotina"	Rosaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Endonuclease; Glycoprotein; Hydrolase; Nuclease; Secreted; Signal | Ribonuclease S-4 precursor (EC 3.1.27.1) (S4-RNase).Secreted, extracellular space."	--NA--	DPTDKLFTVHGLWPSNRNGPDPEKCKTTTMNSQKIGNMTAQLEIIWPNVLKATIQPNGNNRSLVDIENAIRSGNNNTKPKFKCQKNTRTTTELVEVTLCSMGITGMTYMFTMVLSLIVLIFSASTVGFDYFQFTQQYQPAVCNSNPTPCNNRDLTKFINCPHGPPKGSRYFCPANVKYNRSDHVGFWEREWLKHGTCGYPTIKDDMHYLKTVIKMYITQKQNVSAILS	228	"Experimental evidence at protein level"	25857.65	25840.8	9.17	--NA--	"FUNCTION:Self-incompatibility (SI) is the inherited ability of a flowering plant to prevent self-fertilization by discriminating between self and non-self pollen during pollination. In many species, self-incompatibility is controlled by the single, multiallelic locus S.CATALYTIC ACTIVITY:Two-stage endonucleolytic cleavage to nucleoside 3'-phosphates and 3'-phosphooligonucleotides with 2',3'-cyclic phosphate intermediates.PTM:The N-glycans attached at Asn-101, Asn-160 and Asn-175 consist predominantly of disaccharide (GlcNAc-GlcNAc). The N- glycan at 87 is 53% monosaccharide and 47% disaccharide. The N- glycan at Asn-144 contains mannose and xylose.SIMILARITY:Belongs to the RNase T2 family."