PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5157	RNS1_PYRPY	--NA--	"Pyrus pyrifolia, Pyrus serotina"	Rosaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Endonuclease; Glycoprotein; Hydrolase; Nuclease; Signal | Ribonuclease S-1 precursor (EC 3.1.27.1) (S1-RNase)."	--NA--	DPTDKLFTVHGLWPSNRNGPDPEKCKTTALNSQKIGNMTAQLEIIWPNVLDRDLKKFINCPHGPPQGSRFSCPSSVQYKAAIQPNGTNRPLVDIENAIRRGTNNTKPKFKCQKNTRTTTELVEVTLCSMGVTGMTYMFTMVFSLIVLILSSSTVGYDYFQFTQQYQPAVCNSNPTPCNNRSDHVGFWEKEWIKHGTCGYPTIKDDMHYLQTVIRMYITQKQNVSAILS	228	"Experimental evidence at protein level"	25791.49	25774.77	8.99	--NA--	"FUNCTION:Self-incompatibility (SI) is the inherited ability of a flowering plant to prevent self-fertilization by discriminating between self and non-self pollen during pollination. In many species, self-incompatibility is controlled by the single, multiallelic locus S (By similarity).CATALYTIC ACTIVITY:Two-stage endonucleolytic cleavage to nucleoside 3'-phosphates and 3'-phosphooligonucleotides with 2',3'-cyclic phosphate intermediates.PTM:N-linked core structure at Asn-87 and Asn-101 contains xylose and fucose or consists of disaccharide (GlcNAc-GlcNAc). N-linked core structure at Asn-144 contains xylose.SIMILARITY:Belongs to the RNase T2 family."