PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5149	RNS6_PYRPY	--NA--	"Pyrus pyrifolia, Pyrus serotina"	Rosaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Endonuclease; Glycoprotein; Hydrolase; Nuclease; Signal | Ribonuclease S-6 precursor (EC 3.1.27.1) (S6-RNase)."	--NA--	DPPDKLFTVHGLWPSNDVGDDPIYCKNKTIKSQQIGNLTAQLIIIWPNVLDRNLTQFIDCPRSSFKGSPFHCPTNHILYDRTDHVGFWNRQWNKHGSCGKAPTIKDEMHYFKTVIKMYITQKQNVSEILMGITGMIYMVPMVFSLIVLISCSSTMGYNYFQFTQQYQPAVCNSNPTPCKSRAKIEPEGKIRRRDDIINAIRLGTKDKKPKLKCQKNNQTTELVEITICS	229	"Experimental evidence at protein level"	26278.43	26261.26	9.17	--NA--	"FUNCTION:Self-incompatibility (SI) is the inherited ability of a flowering plant to prevent self-fertilization by discriminating between self and non-self pollen during pollination. In many species, self-incompatibility is controlled by the single, multiallelic locus S.CATALYTIC ACTIVITY:Two-stage endonucleolytic cleavage to nucleoside 3'-phosphates and 3'-phosphooligonucleotides with 2',3'-cyclic phosphate intermediates.PTM:The N-glycans attached at Asn-188 and Asn-203 consist of either monosaccharide (GlcNAc) or disaccharide (GlcNAc-GlcNAc) that could not be distinguished.SIMILARITY:Belongs to the RNase T2 family.CAUTION:Gln-112 is present instead of the conserved Glu which is expected to act as an active site proton donor."