PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5145	GL19_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Apoplast; Complete proteome; Glycoprotein; Manganese; Metal-binding; Secreted; Signal | Putative germin-like protein subfamily 1 member 9 precursor.Secreted, extracellular space, apoplast (By similarity)."	--NA--	DPKLVTVEDFFFTGLHEARPPNPKTGSNVTAVNVNNLPGLNTLGISLVRIDYGVYGQNPPHTHPRASEVLYVAVGTLFVGFVTSNPENRLFSKTLYEGDVFVFPQGLIHFQVNVGKYPAVAFAGLSSQNPGVITIADTVFGSNPQIDPSFLASAFQVDPKIVMDLQTKFIKPMKSFSFLAVLSILAITLSLSKASDPSSLQDFCVGVNTPADGVFVNGKFCK	222	"Protein inferred from homology"	23884.39	23869.37	6.46	--NA--	"FUNCTION:May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.SUBUNIT:Oligomer (believed to be a pentamer but probably hexamer) (By similarity).SIMILARITY:Belongs to the germin family."